PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1902aa    MW: 210040 Da    PI: 6.763
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597447.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-1211331174346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                       +WT+eE e ++d  +++G++ +k+Ia+++   +t  +c+++++k
   XP_013597447.1 1133 PWTPEEKETFLDMLAMHGKD-FKKIASYLS-QKTTADCVEYYYK 1174
                       8*****************99.*********.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.51E-1511171178IPR009057Homeodomain-like
PROSITE profilePS5129316.05211291180IPR017884SANT domain
SMARTSM007171.6E-1111301178IPR001005SANT/Myb domain
PfamPF002491.0E-911321174IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-811331178IPR009057Homeodomain-like
CDDcd001671.34E-811331175No hitNo description
PROSITE profilePS5129310.91613351386IPR017884SANT domain
SMARTSM007173.0E-513361384IPR001005SANT/Myb domain
SuperFamilySSF466895.77E-813391386IPR009057Homeodomain-like
CDDcd001671.20E-413401381No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1902 aa     Download sequence    Send to blast
MPQDHASWDR KELPRLRKRD RPSEPPPPFD SPPSPSSHRD FSRWGSASDF RRPNCNGKQG  60
GRYDFEEETS HGYTSSRSSA RMFENDYHRP LAPRGDWRYA RNFRDDRVPF SHKDWKGDTW  120
EMNNGSSRDF ERPFGVRNGR RSVDERPPHA SDTHTTLVNT WDPPPNFTHQ PEMCTPVRTL  180
KFANEQNNSD QRPSSLPIDP RPDRPSSENS YDNKECSTEN QCNGLMYARR LAYDNSLEPP  240
IRNTELEGTR KPHLKDMQDN RLRGVGDLDG AMKSGKESSL GAVGKLPVWP QDHTSWDRKE  300
LLRPRKRERP SEPPFDSPSS HHVPREYSRW GSGDFRRPNC HGKQGGRYQF AEETSHDYYR  360
QSAPRGDWRY TRNCRDDRVP LSQKEKCNTL DMSNSSSRAF ERPCGVRNGR RSVDERPLHA  420
SDAHTTLVNS WDSPNSTHQP DIEMCTPVQT LKFKNELKFS DQRPSLPIDP HSDCLSLSER  480
PSSENSYENK ECSTANQSNG LMYARRLAND NSLDPPIRHA ELEGTRKQLH LENMEDNRLR  540
GGLRGVSDLD GTMKSGKESS LGATGKPPVC SGSFSSQSSG FSHSSSFKSL GAGDSSDRKQ  600
KVIPKIVAAT QSSSGDATAC ATTTLSEEMI ARKKRLGWGE GLAKYENKKV DVNTTEDGTA  660
LLENGTGELR SLNKNITDES PTAAIAPDYG SPTTPSSVDC SSSPGFADKS SAKAAIGASD  720
VSNMCRSPSP VSSNYLERLP INIDELDDVS MERFGCLLSE LLGTDDPVIG DFCSAQLTSM  780
NRLLAWKGDI LKAVEMAESE IDLLENKQKA LKIEGGRQCR VVEPSSYVCQ GDENVFKKQE  840
NPCILGPKIV ASSVAETLVR DPVHQAVSAK APVEIFGDST GEVKSLTQAF ATAGSNEDIL  900
PIPSVRAVAS SKAINTSAVS SQEAIDLFSA DDMVSNEDLH CAKLLSTNKI YASESSGVFN  960
ELLPREFSSF DDLRFLGVRQ RQFDSHVKEK IADRIELLRA REKILLLRFK AFQFAWKKDL  1020
HQLALTKRQP KSNKRTEVLP NAKISGRLKL PQPLRLRLSS SAQRRDSVAS TTELVSYMKK  1080
LQNGTHLTPF RDILRMPAMI LDEKERARSR FISSNGMIED PCDVEKERTK INPWTPEEKE  1140
TFLDMLAMHG KDFKKIASYL SQKTTADCVE YYYKNHKSDS FGKIKKQRGY GKEGKHTYML  1200
APRKKWNREM GAASLDILGA VSIIASNAGK VASTRQISSK RITLRGSSSS SSLQHDGKYS  1260
EGCSHSFGFP RKRNLGADVV AVGPLSSEQI NSREECMYHL KIDPAAKKPR ISHSTHNENS  1320
NEDDDSCSEE SCEETGPIHW TDAERSAFIQ GFSLFGKNFA SLSSFVRTRS PDQCRVFFSK  1380
VRKCLGLECR QSGSANVSTS ASVDNANEGV GGSDLEDPCA MESIAAICND GVSAKIGLNS  1440
PTSPFNMNQD GANHSGSANV EAGLSRSEQD IGLTLLCLKD GTSLVNNACS NGDFPGVVSE  1500
PLVNNITGET QCQAAEQINS NDPLSMEIDE GNLTSVAEET IKSSDQLSME LEEGNLTPVA  1560
VSSDPLYCGA SAIIVETPTE SSHKGSGGEG AALPNQSSKQ QDGVNEAANR AINNGLEAEA  1620
APSSFRYPEC LHHVPIEEDL VDVSVPQGDP SCHTESELSN SLVVQTNNMG WQFSEVNLNL  1680
DRRLRIVGHV KPEQSGRLNA TSTEPCQIPW RSFTQDPSRI SRSKSDLIVN NQHTGEGFSL  1740
KKCTSSATKP LTVFHKDGRS GHSRSHSFSL SDSERLDKNG DVKLFGTVLT ADDNGSKQKQ  1800
NPGASIRSSS TLSGDHQYIN QQHLQNVPIT SYSFWDGSRI QTVLTSLPES AKLLASYPEA  1860
LSTHLKQQVV SSKEIQLDVS GILSFGKHIE ERADVSSGKD ER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-1710911181493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-1710911181493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597447.10.0PREDICTED: uncharacterized protein LOC106305642 isoform X1
TrEMBLA0A0D3DE470.0A0A0D3DE47_BRAOL; Uncharacterized protein
STRINGBra012815.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein